SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9FNC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9FNC5
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily XseB-like 4.18e-18
Family XseB-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E9FNC5
Sequence length 71
Comment (tr|A0A0E9FNC5|A0A0E9FNC5_CHLTH) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome OX=813 OS=Chlamydia trachomatis. GN=ERS133249_00563 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MPNKKLKFQEAMTRLDEIVTKLSSNDLDLEEAMDLFTEGLKLSTQCEKQLKEFETKIEAI
THQEAQDGTAE
Download sequence
Identical sequences A0A0E9FNC5 R5ZE89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]