SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9FRR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9FRR2
Domain Number 1 Region: 50-172
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.22e-26
Family Insert subdomain of RNA polymerase alpha subunit 0.00065
Further Details:      
 
Domain Number 2 Region: 250-313
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 2.62e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 11-50,173-226
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 3.34e-20
Family RNA polymerase alpha subunit dimerisation domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9FRR2
Sequence length 316
Comment (tr|A0A0E9FRR2|A0A0E9FRR2_CHLTH) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome OX=813 OS=Chlamydia trachomatis. GN=ERS133249_01815 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MQEFERATFHKESLNEENTSGSYVFEPLERGFGTTVGNTICSTMLSDLPGTKVIAFRVDG
SNVDDLTVDGVREDVITIGLNLKAVKLLNEVEGPVCLHISKQGPALVTSADMICPEGVTL
VDPEQVVCNLEKSASLEMDIIIAKGYGYKSAEDNKADYELADDMHVLDAIFTPIRKAEYK
SEPARIGFDKKYDKVHFDVTTDGTITPLDAISTSASKVIDILDAIIPVADLDLEESFAVQ
ETHEEETQKVNTMMIEDLDLSVRSYNCLKRAGIQTVDELTQKTEDEMMHVKNLGKKSLKE
VKDKMYQLNLFFKSYE
Download sequence
Identical sequences A0A0E9FRR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]