SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9M5W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9M5W0
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily DsrEFH-like 4.37e-40
Family DsrEF-like 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E9M5W0
Sequence length 119
Comment (tr|A0A0E9M5W0|A0A0E9M5W0_9PROT) Putative sulfurtransferase DsrE {ECO:0000313|EMBL:GAO32863.1} KW=Complete proteome; Reference proteome OX=1188319 OS=Ferriphaselus amnicola. GN=OYT1_00906 OC=Gallionellaceae; Ferriphaselus.
Sequence
MKFGIVVNEGPYQHQASDSAYLFAKAAIAAGHEVWRVFFYHDGVNNASRLTAPPQDDRNV
VNRWSKMADEHKVDLVVCVAAALRRGIQEENLAAGFRISGLGQLVEAGIQCDRLVTFGD
Download sequence
Identical sequences A0A0E9M5W0
WP_062626109.1.78779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]