SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E9MIN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9MIN4
Domain Number 1 Region: 171-355
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.31e-70
Family Methylesterase CheB, C-terminal domain 0.000000534
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily CheY-like 4.27e-28
Family CheY-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E9MIN4
Sequence length 357
Comment (tr|A0A0E9MIN4|A0A0E9MIN4_9PROT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1632857 OS=Sulfuricella sp. T08. GN=SCT_2810 OC=Gallionellaceae; Sulfuricella.
Sequence
MKKIKVMVVDDSAVVRQVVQAILDQEPDIEVIGAASDPIFAIDRMNKQWPDVIVLDIEMP
RMDGITFLKKIMAEHPTPVVICSSLAEKGAATTMQALEAGAVEIITKPQVGLKRFLEESS
HELVTAVRAAAMANVKRLKAAPIAAVKMAPAPKLNADAILAAPGSHAMAQTTERIVAIGT
STGGTQALEAVLTALPRVCPGIVIVQHMPEKFTASFAARLNELCQIEVREARHNDRVIPG
LALIAPGGKHMLLKRSGAYYHVEVVDGPLVNRHRPSVDVLFRSVAKFAGKNATGFIMTGM
GDDGARGMKEMHEAGAPTIAQDEATCVVFGMPKEAIKLGGVDRVMGLQDIPRAILSG
Download sequence
Identical sequences A0A0E9MIN4
WP_059424230.1.60282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]