SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E9MZF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9MZF2
Domain Number 1 Region: 236-497
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.91e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.036
Further Details:      
 
Domain Number 2 Region: 13-247
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.24e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0095
Further Details:      
 
Domain Number 3 Region: 515-616
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000487
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E9MZF2
Sequence length 618
Comment (tr|A0A0E9MZF2|A0A0E9MZF2_9BACT) Putative 2-oxoglutarate--ferredoxin oxidoreductase alpha subunit {ECO:0000313|EMBL:GAO42888.1} KW=Complete proteome; Reference proteome OX=1220578 OS=Flavihumibacter petaseus NBRC 106054. GN=FPE01S_01_19060 OC=Chitinophagaceae; Flavihumibacter.
Sequence
MIRKDEVLSEVVIKFAGDSGDGMQLTGTQFTNNTALLGIDLATFPDFPAEIRAPQGTIPG
VSGYQLRFSSDRIYTPGDECDVLVAMNAAALKTNLKALKKGGKIIANTDGFDAKNLRLAN
YPEGVNPIEDNSLTNYEVIRMDVTKMTREALKEFTLGTKEKDRAKNMFVLGFLYWMYNRD
MASSIQFLKDKFGKKPELLDSNIKALQAGYNYGDTTETFTTRYTVDKARMEPGLYRNIMG
NQALAFGLIAASDKSNLPLFLGTYPITPASDILHELSKYKTFGIRTFQAEDEIAGITAAI
GASYGGSLGVTTTSGPGMALKTEAMGLAVMLEIPLLIVNIQRGGPSTGLPTKTEQSDLLQ
AYYGRNGECPMPVIAASTPSDCFNAVYEAARIAVEHMTPVIFLSDGYIANGAEPWKFPTS
DHLHPIAVSFKTDLGYGEDKFMPYLRNEKLVRPWAIPGTPGLEHRVGGLEKQNITGNISY
DPDNHQLMVKIRQEKVDKIAEYIPEQTIDSGPAKGQVLVLGWGSTYGAIKSAVAEMQSLG
YAVSHAHLRHLRPFPKNLGHMLEQFDQVLIPEINNGQLIRIIRDQFLIDAKGYNKIMGVP
ITKTELVQKLKEMLGGLN
Download sequence
Identical sequences A0A0E9MZF2
WP_046368476.1.6184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]