SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9ZI06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9ZI06
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-58
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E9ZI06
Sequence length 191
Comment (tr|A0A0E9ZI06|A0A0E9ZI06_9PSED) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1546029 OS=Pseudomonas sp. 10-1B. GN=TZ03_21040 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNGVRAVVIGASAGGVAALLKVLGALPAGFAIPVLCVLHLPDDRHSQLAEVLQRRLHRPV
REARDKESVRAGQIYVAAPGYHLSVERDLTLSLSQEPAVHFSRPAIDYLFMSAADAYGSS
LLGVLLTGANEDGAEGLAYIKHNGGRTVVQDPHDAQVALMPEAALALHRPDHILSLSGIE
QLLAALEPSAC
Download sequence
Identical sequences A0A0E9ZI06
WP_051100189.1.65173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]