SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F0CLZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0CLZ8
Domain Number 1 Region: 8-183
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.06e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F0CLZ8
Sequence length 194
Comment (tr|A0A0F0CLZ8|A0A0F0CLZ8_9BACT) 2-oxoglutarate ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KJJ84257.1} KW=Complete proteome; Reference proteome OX=1609969 OS=Candidatus Omnitrophus magneticus. GN=OMAG_001874 OC=Bacteria; Candidatus Omnitrophica; Candidatus Omnitrophus.
Sequence
MKNNINDSIICAGFGGQGVMILGKFLANAGIKENLNVTWLPSYGIEVRGGTAYSSIRINS
DHIATPVVNFPNTAIIMNEPSLIKFEEKIEPRGFLILNSSMNKAAVKRKDINVLSIFLTD
EALELGNIKVANMIAAGIYAAIRKMFKKDTLLKVIEEMAGGHEELTLINIKAIERGMEIG
EEYINRQTKPVIIF
Download sequence
Identical sequences A0A0F0CLZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]