SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F0E1B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0E1B2
Domain Number 1 Region: 150-334
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.63e-61
Family Methylesterase CheB, C-terminal domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 4.41e-22
Family CheY-related 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F0E1B2
Sequence length 335
Comment (tr|A0A0F0E1B2|A0A0F0E1B2_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1619948 OS=Pseudomonas sp. 21. GN=UB43_08315 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKIGIVNDMPLAVEAMRRALAFEPAHRIVWVAANGAEALEMCAAHKPDVILMDLLMPVMD
GVEATRRIMAQSPCAIIVVTVDLERNMSRVFDAMGNGAVDAVNTPVMGAGDPAEAARPLL
RKLQNLAWLNAPRDSRPAISAVPARKGSGARKLVAIGSSAGGPAALADLFARLPADFPAA
IVVVQHVDEVFAAGMAEWLSTQSRIPVRLARNGEPPQPGCVLLAGTNHHIRLLKGGELAY
TAEPSSHIYRPSIDVFFDSVVEYWVGDAVGVLLTGMGRDGAEGLKHMRERGYLTLAQDQE
SSAVYGMPKAAAAIGAAVEIRALGDIARRLAEVCA
Download sequence
Identical sequences A0A0F0E1B2
WP_045209955.1.45794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]