SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0TXN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0TXN6
Domain Number 1 Region: 3-247
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-79
Family LplA-like 0.000000000745
Further Details:      
 
Domain Number 2 Region: 248-335
Classification Level Classification E-value
Superfamily SufE/NifU 9.94e-24
Family SP1160 C-terminal domain-like 0.00000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F0TXN6
Sequence length 338
Comment (tr|A0A0F0TXN6|A0A0F0TXN6_ENTCL) Lipoate--protein ligase {ECO:0000256|HAMAP-Rule:MF_01602} KW=Complete proteome OX=336306 OS=Enterobacter cloacae subsp. cloacae. GN=SS44_03925 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MTTLRLLLSDSYDPWFNLAVEECIFRQMPATQRVLFLWRNADTVVIGRAQNPWKECNTRR
MEEDNVRLARRSSGGGAVFHDLGNTCFTFMAGKPEYDKTISTSIVLNALNSLGVTAEASG
RNDLVVKTPDGDRKVSGSAYRETLDRGFHHGTLLLNADLSRLANYLNPDKKKLQAKGITS
VRGRVANLVELLPDITHAQICEAIQEAFFAHYGERVEAEVISPDKTPDLPNFAETFARQS
SWEWNFGQAPAFSHLLDERFTWGGVELHFDVEKGHITRTQVFTDSLNPAPLEALAARLQG
CLYRADMLQQDCDALIGDFPEQENELRELSAWIARAVR
Download sequence
Identical sequences A0A0F0TXN6
WP_040020129.1.12136 WP_040020129.1.40063 WP_040020129.1.67678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]