SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F0VTP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0VTP7
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.4e-74
Family Methylesterase CheB, C-terminal domain 0.0000000174
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.34e-27
Family CheY-related 0.00000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F0VTP7
Sequence length 349
Comment (tr|A0A0F0VTP7|A0A0F0VTP7_PLUGE) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=61647 OS=Pluralibacter gergoviae (Enterobacter gergoviae). GN=ABW06_01425 OC=Enterobacteriaceae; Pluralibacter.
Sequence
MKKIRVLSVDDSALMRQIMTEIVNDHDDMEMVATAQDPLVARDLIKKFDPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAVDFVTKPQLGIREGMLAWS
DAIADKVRAASRARVGAHRPAAAPVVLKSGPLLSSEKLIAIGASTGGTEAIRHVLEPLPL
TSPAILITQHMPPGFTRSFAERLNKLCQITVKEAEHGERVLPGHAYIAPGDRHMTLARSG
ANYQIQLHDGPPVNRHRPSVDELFNSVALHAGRNAVGVILTGMGNDGAQGMYAMHQAGAW
TLAQSEASCVVFGMPREAINGGGVSEVVDLSNISQQMLAKISAGQAIRI
Download sequence
Identical sequences A0A0F0VTP7
WP_045289206.1.11478 WP_045289206.1.1728 WP_045289206.1.18312 WP_045289206.1.28923 WP_045289206.1.4217 WP_045289206.1.92332 WP_045289206.1.92621 WP_045289206.1.9837 WP_045289206.1.99355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]