SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2C880 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2C880
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.19e-29
Family Ribosomal L11/L12e N-terminal domain 0.0000719
Further Details:      
 
Domain Number 2 Region: 69-142
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.96e-26
Family Ribosomal protein L11, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2C880
Sequence length 143
Comment (tr|A0A0F2C880|A0A0F2C880_9MICO) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome; Reference proteome OX=1263625 OS=Microbacterium sp. SA39. GN=RS85_02185 OC=Microbacterium.
Sequence
MAPKKKVTGLIKLQIKAGAANPAPPIGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEI
TVYEDRSFTFILKTPPAAELIKKAAGIPKGSATPHTVKVAKITKAQVREIAETKQADLNA
NDIEAASKIIAGTARSMGITVEG
Download sequence
Identical sequences A0A0F2C880
WP_046013455.1.86303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]