SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2ITM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2ITM5
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily DsrEFH-like 4.71e-22
Family DsrEF-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2ITM5
Sequence length 118
Comment (tr|A0A0F2ITM5|A0A0F2ITM5_9BACT) DsrE family protein {ECO:0000313|EMBL:KJR40391.1} KW=Complete proteome; Reference proteome OX=1609970 OS=Candidatus Magnetoovum chiemensis. GN=MCHI_003719 OC=Candidatus Magnetoovum.
Sequence
MAKFLFVLTRGLDDPIRATRGLMLAKVAKEKGHDVHIFLTDDAVLLAKEGLLDNVMTPSG
DEALSHMGFLIANNVPISVCLPCAQVRKLGEAELIENAKYGKAPELIDIAEDAKVFTF
Download sequence
Identical sequences A0A0F2ITM5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]