SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2KSK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2KSK2
Domain Number 1 Region: 278-359
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 1.28e-30
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000307
Further Details:      
 
Domain Number 2 Region: 18-101
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 1.83e-29
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00014
Further Details:      
 
Domain Number 3 Region: 199-277
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 2.35e-19
Family Methylated DNA-protein cysteine methyltransferase domain 0.00071
Further Details:      
 
Domain Number 4 Region: 95-142
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000344
Family AraC type transcriptional activator 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2KSK2
Sequence length 374
Comment (tr|A0A0F2KSK2|A0A0F2KSK2_9PROT) 6-O-methylguanine DNA methyltransferase {ECO:0000313|EMBL:KJR62600.1} KW=Complete proteome OX=528244 OS=Azospirillum thiophilum. GN=VY88_27310 OC=Rhodospirillaceae; Azospirillum.
Sequence
MARTMEHAKGSQGRSVAEDPRWARVLARDRTADGQFWYSVATTGVYCRPSCPSRPANPEN
VGLHETLEAARATGFRPCKRCKPDGPSLDAENAAIVAKACRLIESSDAPPSLADLAAVVG
RSPGYLHRLFKASTGLTPKDYAVGRRAARVRDNLTADNTVTEAIYDAGFNSSGRFYEKST
EMLGMTPSRYRAGGENEDIRFAVGDSSLGAILVASSAKGVAAILIGDDPDDLARDLQDRF
PKARLIGGDAEYEALVAKVVGLVEAPGLGLDLPLDVRGTAFQQRVWQALREIPAGETASY
TDIALRIGLPKAVRAVAGACAANNIALAIPCHRVVRNDGALSGYAWGVERKRTFLEREKA
APGPRPAAGLGKAE
Download sequence
Identical sequences A0A0F2KSK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]