SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2LEX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2LEX3
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.18e-22
Family HEPN domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2LEX3
Sequence length 125
Comment (tr|A0A0F2LEX3|A0A0F2LEX3_9CREN) Uncharacterized protein {ECO:0000313|EMBL:KJR74351.1} KW=Complete proteome; Reference proteome OX=1609232 OS=Thermoproteus sp. AZ2. GN=TU35_00520 OC=Thermoproteaceae; Thermoproteus.
Sequence
MEFLRSRALQFLEQANYAHQRGYNELALFNVEQFFQLYVKYLLYKRLGEYPRTHSLKRLL
EELVRLYQGCGISEYIRENSLIITLLEQAYISSRYLPFEADEGDVEAAMDAAKRALEIFK
CLENL
Download sequence
Identical sequences A0A0F2LEX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]