SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F2N425 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2N425
Domain Number 1 Region: 187-374
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-63
Family Methylesterase CheB, C-terminal domain 0.0000056
Further Details:      
 
Domain Number 2 Region: 5-116
Classification Level Classification E-value
Superfamily CheY-like 2.28e-28
Family CheY-related 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2N425
Sequence length 376
Comment (tr|A0A0F2N425|A0A0F2N425_9DELT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1629713 OS=Desulfobulbaceae bacterium BRH_c16a. GN=VR65_26840 OC=Desulfobulbaceae.
Sequence
MIGSKNLRVLVVDDTIVYRKAVSDILAEIPGVELVGVAHNGKIALAKIQTLKPDILTLDI
EMPEMNGIEVLAELQKSHPGIGAVMLSTLTAEGSEMTMRALELGAFDFILKPQSKNQTEG
KKEIKASLEPILKAFARSKNAASLIGRKGLIAAPPSHGRTLPGQPPTQARGLRPLAQKFP
AGRRGKSEIVAIGISTGGPNALNQMLPKLPGNLGVPVLIVQHMPPVFTKSLASSLDKKCA
LTVKEAVNGENILPNVVYIAPGGKQMKLVAGTDGQNRRIKITDDPPENSCRPSVDYLFRS
VADYYVGRATAVIMTGMGSDGTLGLGILKEKSAYIIGQDEGSCIVYGMPKAPAEMGYLDI
VAPLNKIADEIVSSVK
Download sequence
Identical sequences A0A0F2N425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]