SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2NF26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2NF26
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.98e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2NF26
Sequence length 175
Comment (tr|A0A0F2NF26|A0A0F2NF26_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KJR99770.1} KW=Complete proteome; Reference proteome OX=1629716 OS=Peptococcaceae bacterium BRH_c4a. GN=VR68_08535 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae.
Sequence
MAGIILAVGAIRDGHHVAQTQAYGPEARGGASRAEVILGSDPIDYPHLEKPDIILALTQE
ACDKYVPSASPGALVIVDSLLVQTVPETRADILRIPVAQTAKQDLGREMVANIVALGALN
EVAQLVTWPSLEAAVLEMVPPGTSDLNTRALTAGKKLAAALRAGIQNPESRIQNT
Download sequence
Identical sequences A0A0F2NF26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]