SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2NLC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2NLC4
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-35
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2NLC4
Sequence length 182
Comment (tr|A0A0F2NLC4|A0A0F2NLC4_9DELT) 2-oxoglutarate ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KJS02803.1} KW=Complete proteome; Reference proteome OX=1629713 OS=Desulfobulbaceae bacterium BRH_c16a. GN=VR65_03895 OC=Desulfobulbaceae.
Sequence
MNRTRLVFSGSGGQGVITAAIILAEAAVIHEGMNATQSQSYGAAARGGATRSDIILSDNE
INFPVVTQPNILVCLTQEAYTSFAPIIRPGGTLLTDSRFVQTTKKVDARQIELPIYDSVM
EKIGKPIVFNISVLGVLLGITPLVRDESLLAVIKERVPKDFIGLNTDAFNLGLSIGRGYF
SN
Download sequence
Identical sequences A0A0F2NLC4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]