SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F2PW87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2PW87
Domain Number 1 Region: 4-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.75e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2PW87
Sequence length 182
Comment (tr|A0A0F2PW87|A0A0F2PW87_9FIRM) 2-oxoglutarate ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KJS16882.1} KW=Complete proteome; Reference proteome OX=1629717 OS=Peptococcaceae bacterium BRH_c4b. GN=VR69_07760 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae.
Sequence
MTERVEICLSGSGGQGIILAGIILADAVIREGKSVVQSQSYGPEARGGASRAEVIIGGDE
LDYPKINSPDILLAMSQEASDKYLKRLRQGGMGILDSTYVGLPSESGVKVFHLPISSMAI
TRLGREMMANMVALGALVRITGIVGRESIEEAVRARVPLGSLDMNLSALDMGRELAIKFS
SQ
Download sequence
Identical sequences A0A0F2PW87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]