SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F2QC61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2QC61
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.84e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2QC61
Sequence length 178
Comment (tr|A0A0F2QC61|A0A0F2QC61_9CLOT) 2-oxoacid:ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KJS22482.1} KW=Complete proteome; Reference proteome OX=1629719 OS=Clostridiaceae bacterium BRH_c20a. GN=VR72_05390 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae.
Sequence
MLEEIVIAGFGGQGVMSMGQLLAYAGMLENKQVAWIPSYGPEMRGGTANCAVTISNTEIS
SPLVTEPSVCIVMNKPSLDKFEPTIKTGGLLFVNTSLIDAKPKREDISIYEIPANAIANE
IGNSKVANMVMLGAVLEVIKAIEPESILESLRKVLPPQRHNLIPLNAQALQKGAEMVR
Download sequence
Identical sequences A0A0F2QC61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]