SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F2RL54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2RL54
Domain Number 1 Region: 241-498
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.63e-57
Family PFOR Pyr module 0.04
Further Details:      
 
Domain Number 2 Region: 18-225
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000000000314
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 517-618
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000068
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2RL54
Sequence length 619
Comment (tr|A0A0F2RL54|A0A0F2RL54_9PROT) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KJS39318.1} KW=Complete proteome; Reference proteome OX=1629718 OS=Rhodospirillaceae bacterium BRH_c57. GN=VR70_08405 OC=Rhodospirillaceae.
Sequence
MPSSALAAATATEALDRVTVRFAGDSGDGMQLTGSIFTESTALASHDLSTFPDYPAEIRA
PTGTTYGVSAYQINFGAQGVLTAGDAPDLLVVMNPAALMVNVAALKAGATIILDSDAFGT
RAIERAGYTTDPRADNSLAPFTVVDLPITSLTQQAAQPLGLSKREAQRCKNVWTLGLVLW
MFDRDRAPIIEALRTKFRKAPEIAEANVAVLNAGHAYGETAEIPALRRLPVTRSLPAPGL
YRTVTGAEATALGLVAGAELTGLDMFLGTYPITPASPMLHHLARLRDWGVTTFQAEDEIA
AVCAAIGASYAGKLGVTTSSGPGIALKTEALGLAISAELPLVVVNAQRGGPSTGLPTKTE
QSDLFQAVMGRNGDAPIPVIAARSPSDSFDAAIEAVKIAVRHMTPVFLLIDGYIGNASEP
WHLPDMDTYERAPVAFRRPDDGTGAFDRDPESLGRQWTLPGTPGLEYRIGGLEKDFSTGA
VSYDSANHQRMTDLRSGKMDAIARALPPQEVCEGPTSGKLAVVAWGSTYGPVHRAVVEAN
RMGRAVAHIHLRHIAPFAPNLTDLLAGFDTVLVPEMNTGQLALLLQAHTLRKVERLNKVT
GQPFKIAEISAAIESALES
Download sequence
Identical sequences A0A0F2RL54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]