SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F2SJF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2SJF4
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2SJF4
Sequence length 181
Comment (tr|A0A0F2SJF4|A0A0F2SJF4_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KJS50351.1} KW=Complete proteome; Reference proteome OX=1629714 OS=Peptococcaceae bacterium BRH_c23. GN=VR66_03255 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae.
Sequence
MLQFIIQGRGGQGAQMAGDILANVFFREGKYVQAYATYGGARRGTAVSSFIRVDDQPIRL
RCNIENPDVIVCFDPSLLNDVLLRGATENTFVIINSAQPPEHFTGLGRFRIVTIDAMAIA
SDNKLGRIVNTTLVGAVAGLLGQPTLEVLCEVVSEMSPVKVDQNLKCCEDGYRLTRKGGV
K
Download sequence
Identical sequences A0A0F2SJF4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]