SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F3GJ92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3GJ92
Domain Number 1 Region: 165-352
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.15e-72
Family Methylesterase CheB, C-terminal domain 0.000000659
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 7.4e-27
Family CheY-related 0.0000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F3GJ92
Sequence length 353
Comment (tr|A0A0F3GJ92|A0A0F3GJ92_9BACT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=29290 OS=Candidatus Magnetobacterium bavaricum. GN=MBAV_005919 OC=Candidatus Magnetobacterium.
Sequence
MKKIRVLIVDDSAVVRQTLSDILSSDPMIEVMATASDPFVAAKRIQDEVPDVITLDVEMP
RMDGITFLKKLMSQHPIPVVMCSSLTDRGSETALKAMEYGAVEIINKPRLGTKQFLEESR
VMICDIIKAAATARLRRPVVEHKVAPKLTADAMLPKPPSKAMVQTTEKIVIVGASTGGTE
ALRVFLEEFPVDCPGIVIVQHMPEHFTAAFAKRLNGICRISIKEAADNDSVVRGRALIAP
GNKHTLLKRSGARYFVEVKDGPLVSRHRPSVDVLFRSAARYAGKNAVGVIMTGMGDDGAR
GMLEMKEAGSTTIAQDEASCVVFGMPNEAIKRNAVDKILPLDRITREVMRICD
Download sequence
Identical sequences A0A0F3GJ92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]