SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3LGB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3LGB2
Domain Number 1 Region: 67-108
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000129
Family H-NS histone-like proteins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F3LGB2
Sequence length 108
Comment (tr|A0A0F3LGB2|A0A0F3LGB2_9GAMM) DNA-binding protein {ECO:0000313|EMBL:KJV42560.1} KW=Complete proteome OX=756892 OS=Acinetobacter indicus. GN=CAP42_12195 OC=Moraxellaceae; Acinetobacter.
Sequence
MMPDISNLSVEQLKRLQEEAEALIASKKDQAVEDAYNQILAIAENAGLSIEQILEFGASK
RKKNVRKSVEPRYRNKANVNETWTGRGKQPRWLVAELEKGAKLEDFLI
Download sequence
Identical sequences A0A0F3LGB2
WP_045796511.1.10886 WP_045796511.1.75920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]