SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3R4Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3R4Z0
Domain Number 1 Region: 1-46
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.0000000558
Family Frataxin-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F3R4Z0
Sequence length 48
Comment (tr|A0A0F3R4Z0|A0A0F3R4Z0_RICAM) Frataxin-like domain protein {ECO:0000313|EMBL:KJV99960.1} KW=Complete proteome OX=1359166 OS=Rickettsia amblyommatis str. Darkwater. GN=RAMDARK_1715 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDQGYM
Download sequence
Identical sequences A0A0F3R4Z0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]