SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3R9C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F3R9C4
Domain Number - Region: 140-166
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 0.00222
Family Transducin (alpha subunit), insertion domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F3R9C4
Sequence length 194
Comment (tr|A0A0F3R9C4|A0A0F3R9C4_9RICK) RPE1 domain protein {ECO:0000313|EMBL:KJW03045.1} KW=Complete proteome OX=1133329 OS=Rickettsia endosymbiont of Ixodes pacificus. GN=REIP_1065 OC=Rickettsiaceae; Rickettsieae; Rickettsia.
Sequence
MSLQSSIYRIRHLSRPTYREEFKGDTERSTAAYIDIREDASTGSTSKLPLEAKFRKMSII
KLVLLLIISTVIYANDKNISNLHITSDTLIIDRTKQKAEYLGNVVVYFDNAILRTKELYI
FYKTIAEKQTIDHVVVPTKLTVERKINNELLLADSAKYFFDNKQLILLGNVILQRDDNVL
KTNKLIYYVDIIKK
Download sequence
Identical sequences A0A067A8P8 A0A0F3R9C4 C4YUT1
WP_008580208.1.23665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]