SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F3ZCX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F3ZCX3
Domain Number - Region: 52-112
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0445
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F3ZCX3
Sequence length 124
Comment (tr|A0A0F3ZCX3|A0A0F3ZCX3_ENTAS) Flagellar biosynthesis protein FliT {ECO:0000313|EMBL:KJX09362.1} KW=Complete proteome OX=61645 OS=Enterobacter asburiae. GN=SG66_17350 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MNNPSAALSHWQALHAQSIAMLNLAHSGQWDALIEQEMHYVQLVEKISQTPIMSCPPAQV
EQARALLEMILENENALKALLKVRMDELRNLIDQTGKQQSITSTYGKLSGNILYPESLTR
DTQL
Download sequence
Identical sequences A0A0F3ZCX3 A0A1M5VIM4 A0A2I6KCP9
WP_033145899.1.14227 WP_033145899.1.22921 WP_033145899.1.29066 WP_033145899.1.35454 WP_033145899.1.36455 WP_033145899.1.37585 WP_033145899.1.38400 WP_033145899.1.48861 WP_033145899.1.49240 WP_033145899.1.57283 WP_033145899.1.63060 WP_033145899.1.73493 WP_033145899.1.75467 WP_033145899.1.81463 WP_033145899.1.86954 WP_033145899.1.90198 WP_033145899.1.9042 WP_033145899.1.90528 WP_033145899.1.99883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]