SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4K211 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4K211
Domain Number 1 Region: 48-169
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 5.89e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000363
Further Details:      
 
Domain Number 2 Region: 14-48,170-220
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.35e-24
Family RNA polymerase alpha subunit dimerisation domain 0.0051
Further Details:      
 
Domain Number 3 Region: 247-318
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.83e-23
Family C-terminal domain of RNA polymerase alpha subunit 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4K211
Sequence length 340
Comment (tr|A0A0F4K211|A0A0F4K211_9ACTN) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome; Reference proteome OX=68223 OS=Streptomyces katrae. GN=VR44_00410 OC=Streptomyces.
Sequence
MLIAQRPSLTEEVVDEYRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRVDGVL
HEFTTVPGVKEDVTDIILNIKQLVVSSEHDEPVVMYLRKQGPGLVTAADIAPPAGVEVHN
PDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQAGQEIGRIPVDSIYSPVLKVTYKVEA
TRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVELFGLARELNIDAEGIDMGPSPTD
AALAADLALPIEELELTVRSYNCLKREGIHSVGELVARSEADLLDIRNFGAKSIDEVKAK
LAGMGLALKDSPPGFDPTAAADAFGADDDADAGFVETEQY
Download sequence
Identical sequences A0A0F4K211
WP_045945292.1.23277 WP_045945292.1.80095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]