SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4L6P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4L6P2
Domain Number 1 Region: 4-157
Classification Level Classification E-value
Superfamily PTS IIb component 3.01e-53
Family PTS IIb component 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4L6P2
Sequence length 158
Comment (tr|A0A0F4L6P2|A0A0F4L6P2_9LACO) PTS Man IIB {ECO:0000313|EMBL:KJY54502.1} KW=Complete proteome OX=1218493 OS=Lactobacillus kullabergensis. GN=JF76_15220 OC=Lactobacillus.
Sequence
MEGIIHIRIDDRLIHGQVATLWTNELGVTRIMVINDQVANNEVQKTMLRMAAPSNVSTSL
LTEEKAVNNIQSGKYKGQRVLVIVKDPETILRLMDKGLDIKKVNVGNMSTRDNTHHIKPS
VSITSDEEKAFRTLLERGVEITAVMVPTDKLVYLKDIL
Download sequence
Identical sequences A0A0F4L6P2
WP_045928512.1.21752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]