SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4NX54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4NX54
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 3.01e-30
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00045
Further Details:      
 
Domain Number 2 Region: 193-288
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.24e-29
Family DNA repair glycosylase, N-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 297-450
Classification Level Classification E-value
Superfamily DNA-glycosylase 8.37e-23
Family DNA repair glycosylase, 2 C-terminal domains 0.001
Further Details:      
 
Domain Number 4 Region: 138-185
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000273
Family AraC type transcriptional activator 0.024
Further Details:      
 
Domain Number 5 Region: 87-132
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000152
Family AraC type transcriptional activator 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4NX54
Sequence length 452
Comment (tr|A0A0F4NX54|A0A0F4NX54_PSEO7) ADA regulatory protein {ECO:0000313|EMBL:KJY87720.1} KW=Complete proteome; Reference proteome OX=43662 OS=Pseudoalteromonas piscicida. GN=TW75_14315 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MYTPEVCSQARNSRDARFDGLFFVAVKSTGIYCRPICPAPAAKEKNVEYFQFAHNAAQAG
FRPCIRCRPDSAPGSYAWLGTETTAVRAKKLIDEGALIRHSTEDLADRLGISVRYLNKVF
NQYFGTSPKQYALYKQCDLAKQLLQQSDLPVTQVAFAAGFNSLRRFNDAFQKLYQLSPSQ
LRKDAGRGSAIAIYLSYRPPYNWDKMQQFLAMRIVPGIEWLTEDSYGRTVMIQGETGRFT
ATIEPEKHRFKVAIALSDLSLLVPMIAQIRRVLDLDADTCFIESHLHEAAPDLPLQEGLR
LPGIWNEFEAGMRAILGQQISVQAAKNLLALLVETLGEVAEDSMRYFPKPKAVFDSDLAF
FKMPERRKAAIKAFAEQYVDLEHVELDNWLNIKGIGPWTVDYAKMRGLSHPDIYLGGDLG
VKKAMEKSLKTIDIEKCAPFRSYLTFQLWQQL
Download sequence
Identical sequences A0A0F4NX54
WP_045964513.1.65041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]