SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F4P174 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4P174
Domain Number 1 Region: 161-348
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.75e-64
Family Methylesterase CheB, C-terminal domain 0.00000148
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily CheY-like 6.69e-25
Family CheY-related 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F4P174
Sequence length 350
Comment (tr|A0A0F4P174|A0A0F4P174_PSEO7) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=43662 OS=Pseudoalteromonas piscicida. GN=TW75_10810 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MSNKISVYIIDDSAVVRQTVTAMLEYSPEICVTKVFSNPVLAQPSVLAEPPDVIILDIEM
PQMDGITFLRWLMANKPIPVIICSSLTTTGAQLSVEALSLGAFEILTKPECGLKSFLESQ
REQFIKVVKQARFYRPKSSTEDISRAPAINVAMSNTNLSINTTDKVVAIGTSTGGTQALE
YIFSQLEPELPGIVVVQHMPANFTKAFAQRLNDLSKLKIKEAEHNERVLANHVYIAPGSH
HLQLVRRGAFYYTQLKDGPPVQRHKPSVNVLFQSVAKQVRSNAVGFILTGMGADGAFGLL
EMKKSGAKTYAQDESSSIVFGMPKEAIKLNAHSQEVTLADVPMTITQCFS
Download sequence
Identical sequences A0A0F4P174
WP_045963782.1.65041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]