SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4PCV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4PCV1
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000000000863
Family FlgN-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4PCV1
Sequence length 142
Comment (tr|A0A0F4PCV1|A0A0F4PCV1_PSEO7) Flagellar biogenesis protein {ECO:0000313|EMBL:KJY92928.1} KW=Complete proteome; Reference proteome OX=43662 OS=Pseudoalteromonas piscicida. GN=TW75_01170 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MDDLVRLCHHKLSEQISTLEAMTQLLARELDELASRRGDNLKEIAREKLTLISKLQKLDN
ELSKTESHVFEHNEVAPLVAKVRALLSECQTKNEINAKTAHQANVSTRELKGILIGAPTS
ITYGQDGSVKSSDSELVRNLKA
Download sequence
Identical sequences A0A0F4PCV1 A0A1E2TZ52
WP_045961738.1.65041 WP_045961738.1.86791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]