SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4PDY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4PDY6
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 7.33e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000262
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.63e-26
Family Ribosomal protein L11, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4PDY6
Sequence length 142
Comment (tr|A0A0F4PDY6|A0A0F4PDY6_PSEO7) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736} KW=Complete proteome; Reference proteome OX=43662 OS=Pseudoalteromonas piscicida. GN=B1L02_01585 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MAKKVEALIKLQVAAGMANPSPPVGPALGQHGVNIMEFCKAFNARTESIEKGAPVPVVIS
VYSDRSFTFEMKTPPAAYLLKKAAGIKSGSGRPNTEKVGTVTRAQLEEIVETKRPDLTAA
DMDAAVRTIAGSARAMGLNVEE
Download sequence
Identical sequences A0A0F4PDY6 A0A1E2TY14 A0A2A2UUP0 A0A2C6DUF0
WP_010376229.1.27036 WP_010376229.1.41942 WP_010376229.1.52088 WP_010376229.1.61158 WP_010376229.1.65041 WP_010376229.1.86375 WP_010376229.1.86791 WP_010376229.1.87641 WP_010376229.1.97401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]