SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F4VED3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4VED3
Domain Number 1 Region: 303-501
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.29e-52
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 24-209
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.85e-48
Family Methylesterase CheB, C-terminal domain 0.00064
Further Details:      
 
Domain Number 3 Region: 1067-1238
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.63e-40
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 4 Region: 1255-1375
Classification Level Classification E-value
Superfamily CheY-like 2.7e-32
Family CheY-related 0.0039
Further Details:      
 
Domain Number 5 Region: 860-985
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-21
Family Heme-binding PAS domain 0.02
Further Details:      
 
Domain Number 6 Region: 996-1079
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000255
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 
Domain Number 7 Region: 233-305
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000288
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0074
Further Details:      
 
Domain Number 8 Region: 768-872
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000646
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 9 Region: 546-650
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000349
Family Heme-binding PAS domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F4VED3
Sequence length 1378
Comment (tr|A0A0F4VED3|A0A0F4VED3_PSEFL) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=VD17_04300 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTTTPKRSDTTSERKPLSPSTLDFPVVGIGASAGGLQAIKLFFENMPQDNGMAFVIILHL
SPDHQSIADKIVQESTKMPVLQVTETVAIEKNRVYVISPAQRLTMNDGFLEVSATDPSEG
RHASIDLFFRDLADVHRERAFCLVLSGTGSDGAVGLSRIKEQGGITLAQAPEDAEFDGMP
CAAIETRMVDLVLPVVEMPQKLLELWRNSREISLPTANDPELQTIAAVSERDAAIAEQVL
RDVLIQLRTGTGHDFKHYKRATVLRRIERRMQVTGQSDLSAYYQYLQNNPEETKALLGDM
LIGVTNFFRDREAFEALERDVVPQLVSAAVSAQPEKEEIRVWSAGCSTGEEAYSLAMLLN
DQLQLDASAASMQLFATDIDERAISVGRAGLYPQAIITDVPPSRLRHYFIKEDDHYRIRK
EIREKVLFAKHSLLSDPPFSQIDLIVCRNLLIYLDREVQREILQMFHFALRPGGFLFLGT
SESADACHELFAPVDKRNRIFRAKTGTANSRRTPTMPRGGYVRTNTSQQVPQSSAPRKLS
FGDIHQRALEQSAPPSVIVDANADILHMSESAGRFLRHVGGELSRNLLTLILPELRLEIR
TTLFQVQQSGLPVKSREVPIKRDKRSYLIDLVAHPYKDDESDGEYVLVIFEEVEVDPAER
AATTVLQTESQVLSNLERELQRTKLHLQDTIEQSEVSSEELKASNEEMQAINEELRSATE
ELETSKEELQSINEELLTVNYELKTKVEETDKINDYLTNLIASTDIATVFVDRGMRIKWF
TPRATDIFSMLPVDTGRSLLDITHRLHYEDLVADAAQVFESLNMIEREVSSTDNRWYIAR
LLPYRSSEDHIDGTVLTFIDITKRRAAEEELRLGEERMRLVAESTRDYAIITLDEQGVIT
TWNKGAELIFGYSKAEAEGAYYDFIFSPEDRASGVPENELLSVRTLGRSEDERWHVRKDG
NRFFCSGEVTLLSGDNLKGYVKIARDLTGHKRQHEEQRQQLAETRNTNYLKDEFFAVMSH
ELKHPLNLIQLNAELLRRLPLTKSVAPAAKAVNTICDAVNSQARIIDDLLDVARVRTGKL
KLKPIAVDLAGVLRDIHAVVLNDRHDVTVELHVPSGALMVHADPTRLEQIIWNLVNNALK
FTPSNGRVQLIASQVGNMARLDVKDNGAGIAPENLDHVFDLFGQAEKQHVSHNREGLGIG
LSLVRQLTEAQRGTVEVNSAGVGTGCTFTVYLPMTQTNGEAQSPTQVEEASGRLSGLTIL
LVDDSADVLETLKMLLEMEDAQVIAFDRPVAALDAAKNTRFDLIISDLGMPVMNGHELMS
ALRQLPLVKDVPAIALTGYGAHSDIQKSRQSGFDQHIGKPVSYDELIETIETLRRSQI
Download sequence
Identical sequences A0A0F4VED3
WP_046052821.1.91498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]