SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F4VW52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4VW52
Domain Number 1 Region: 72-150
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000155
Family Group I mobile intron endonuclease 0.079
Further Details:      
 
Weak hits

Sequence:  A0A0F4VW52
Domain Number - Region: 167-196
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000567
Family Group I mobile intron endonuclease 0.062
Further Details:      
 
Domain Number - Region: 169-274
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00279
Family Group I mobile intron endonuclease 0.06
Further Details:      
 
Domain Number - Region: 1-50
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00681
Family Centromere-binding 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4VW52
Sequence length 289
Comment (tr|A0A0F4VW52|A0A0F4VW52_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:KJZ85728.1} KW=Complete proteome OX=1523154 OS=Clostridium sp. IBUN125C. GN=ClosIBUN125C_CONTIG48g02792 OC=Clostridium.
Sequence
MTKNYNQLTSKDKENIVEYYYLNKKVNMNNIARNLNVSRRSISRVLQEKSVNTRLKNRYV
LNENYFNEINTEAKAYILGFIYADGFVGNENFNNIVIAVNDLEILEFIVKEIEFTGEIRK
TKKGGFTNSKCGYSLNFSSRIMADRLRNIGLYPNKSLTIDSIPIIREELVRHFIRGYFDG
DGSILLSHNSSYYKSYDGIIKYVYPTYNFTILGTKNFLKQIISNAEFKYAKIRNTKTEQI
KSLNICAKKEFDYIFNYLYLDSTIKLERKYNKWYEIKSAFAAGAVKQMR
Download sequence
Identical sequences A0A0F4VW52 A0A0F4WL73 A0A0F4WLK6 A0A1F1KUB5 R0ACY5
WP_002582499.1.1134 WP_002582499.1.34338 WP_002582499.1.36140 WP_002582499.1.42049 WP_002582499.1.65800 WP_002582499.1.70980 WP_002582499.1.72530 WP_002582499.1.80406 WP_002582499.1.86677 WP_002582499.1.86712 WP_002582499.1.87686 WP_002582499.1.91059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]