SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5AR05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5AR05
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000746
Family Ribosomal protein L36 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F5AR05
Sequence length 47
Comment (tr|A0A0F5AR05|A0A0F5AR05_9GAMM) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome; Reference proteome OX=1406902 OS=Salinivibrio sp. KP-1. GN=WN56_08015 OC=Vibrionaceae; Salinivibrio.
Sequence
MKVVNSLKSARQRHPDCQVVRRRGRMFVICKTNPRFKAVQGRAKKRS
Download sequence
Identical sequences A0A0F5AR05 A0A1V3GNX1 A0A1V3I1B8
WP_046074543.1.33111 WP_046074543.1.38350 WP_046074543.1.41728 WP_046074543.1.53917 WP_046074543.1.56108 WP_046074543.1.78221 WP_046074543.1.95609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]