SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F5IB77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5IB77
Domain Number 1 Region: 197-459
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.21e-75
Family PFOR Pyr module 0.024
Further Details:      
 
Domain Number 2 Region: 1-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.27e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0025
Further Details:      
 
Domain Number 3 Region: 470-578
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.72e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F5IB77
Sequence length 591
Comment (tr|A0A0F5IB77|A0A0F5IB77_9BACI) 2-oxoglutarate oxidoreductase, alpha subunit {ECO:0000313|EMBL:KKB42432.1} KW=Complete proteome; Reference proteome OX=1221996 OS=Quasibacillus thermotolerans. GN=QY95_00281 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Quasibacillus.
Sequence
MVNQLSWKVGGQQGEGIESTGEIFSIALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTP
VRTIADDLDILVAFDQETIDLNCGELHENGIIIADAKFKPVKPDHVQADFYVVPFTEIAS
ELGTSLMKNMVAVGASCAVINVEVAAFTGVVEEIFGRKGEAVVQKNMEAIQQGYDYMLSQ
LGDKVSPLQLDEADGRQRMFMIGNDAIALGALTGGVRLMAAYPITPASEIMEYLIEKLPK
VGGTVIQTEDEIAAATMAIGANYGGIRSFTASAGPGLSLMMEAIGLSGMTETPLVVVDTQ
RGGPSTGLPTKQEQSDLMAMIYGTHGEIPKIVLAPSTVEEAFYDTIEAFNLAEEYQCPVI
LLSDLQLSLGKQTVEPLDFSQVEIRRGKLVQEELPEREDKSYFKRYEVTEDGISPRVIPG
MKNGVHHVTGVEHDETGKPSESPANRQAQMDKRMRKLDRLQLNMPVYTNAKHEEADLLLV
GFGSTRGAIEEAVERLEKDGVKVNHAHVRLVHPFPAEELLPLVESAKNIAIVENNATGQL
ANIVKMNVGHAHKIKSLLKYDGNPFQPHHIHEGSKELFELYYSLPSGKESL
Download sequence
Identical sequences A0A0F5IB77
WP_039232561.1.95888 WP_039232561.1.99253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]