SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F5IPS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5IPS9
Domain Number 1 Region: 799-1180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.86e-130
Family PFOR PP module 0.00000000709
Further Details:      
 
Domain Number 2 Region: 417-667
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.05e-81
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000214
Further Details:      
 
Domain Number 3 Region: 6-260
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.53e-74
Family PFOR Pyr module 0.0000000136
Further Details:      
 
Domain Number 4 Region: 261-413
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.29e-51
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000122
Further Details:      
 
Domain Number 5 Region: 670-835
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.46e-18
Family Ferredoxin domains from multidomain proteins 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F5IPS9
Sequence length 1187
Comment (tr|A0A0F5IPS9|A0A0F5IPS9_9BACT) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome OX=1203610 OS=Parabacteroides gordonii MS-1. GN=HMPREF1536_05009 OC=Parabacteroides.
Sequence
MTKQKKFLTCDGNQAAAHISYMFSEVAAIYPITPSSTMAEYVDEWAAAGRKNIFGETVLV
QEMQSEGGAAGAVHGSLQAGALTSTYTASQGLLLMIPNMYKIAGELLPCVFHVSARTLAS
HALCIFGDHQDVMSARQTGFAMLAEGSVQEVMDLSGVAHLATIKSRVPFVNFFDGFRTSH
EIQKIEALENDDLAPLIDQKALAEFRARALNPEKPEARGMAENPDHFFQHRESSNKYYDA
VPAIVEEYMNEISKITGRKYGLFDYYGAEDAERVIIAMGSVTEAAREAIDHLTAQGEKVG
LVSVHLYRPFSAKHFLAAVPKTAKRIAVLDRTKEPGATGEPLYLDVKDCYYGTENAPVIV
GGRYGLGSKDTTPAQILSVYENLALPMPKNQFTLGIVDDVTFTSLPQKEEIALGGEGMFE
AKFYGLGADGTVGANKNSVKIIGDNTNKYCQAYFSYDSKKSGGFTCSHLRFGDHPIRSTY
LVNTPNFVACHVQAYLRMYDVTRGLRENGTFLLNTVWNGEELAKHLPNKVKRYFAQKNIT
VYYINATQIALEIGLGNRTNTILQSAFFRITGVIPVDLAIEQMKKFIVKSYGKKGEDVVN
KNYAAVDRGGEYTQLTIDPSWANLPDDEVVANNDPAFINEVVRPINAQDGDLLKVSAFEG
IEDGTWHQGTAKYEKRGVAAFVPVWEADNCIQCNKCAYVCPHASIRPFVLDTTEQAGAPF
SDSLKATGKQFDGMQFRIQVDVLDCLGCGNCADVCPGNPKKGGKALKMAALETQLAEAPK
WDYCVEKVSSKQHLVDVKANVKNSQFATPLFEFSGACSGCGETPYVKLVTQLFGDREMVA
NATGCSSIYSGSVPSTPYTTNDKGQGPAWANSLFEDFCEFGLGMELANEKMRARLTNAMN
AIIAADNAPAEAKEVLKAWVENQNDADKTKELAPQVLAIAEEGITHGCPLSAQIKELSHF
LVKRSQWIIGGDGASYDIGYGGLDHVIASGKNVNILVLDTEVYSNTGGQSSKATPVGAIA
KFAASGKRIRKKDLGLMATTYGYVYVAQIAMGADQAQTLKAIREAEAYDGPSLIIAYSPC
INHGLRKGMGKSQQEEADAVACGYWHLWRYNPALEEEGKNPFTLDSKEPDWAKFQDFLKG
EVRFSSLAKQFPAEADELFKAAESNAKWRLNNYKRLAKQQWGVEEEA
Download sequence
Identical sequences A0A0F5IPS9
WP_028728654.1.41584 WP_028728654.1.74405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]