SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F5PM70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5PM70
Domain Number 1 Region: 4-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F5PM70
Sequence length 185
Comment (tr|A0A0F5PM70|A0A0F5PM70_9THEO) Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:KKC29713.1} KW=Complete proteome OX=391606 OS=Caldanaerobacter subterraneus subsp. pacificus DSM 12653. GN=CDSM653_01259 OC=Thermoanaerobacteraceae; Caldanaerobacter.
Sequence
MRSLEIRLGGSGGQGLILAGIILAEAAILDGKVSVQSQSYGPEARGGSSKAEVIISDGPI
VYPKVLKPDVLLALTSSAYKSYKEDVKETGLIIVDDSVEVEKESKVKTLKFPILKTAQEV
VGKAYVANIVSLGVIAELTKIVSEESLEKAVLKRVPAGTEELNRKALEEGFKLGKVEDKW
VEQMI
Download sequence
Identical sequences A0A0F5PM70 Q8RA86 U5CUX2
gi|20807789|ref|NP_622960.1| WP_011025639.1.13259 WP_011025639.1.70758 WP_011025639.1.99938 273068.TTE1342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]