SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5VIR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5VIR6
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 8.69e-23
Family Insert subdomain of RNA polymerase alpha subunit 0.0004
Further Details:      
 
Domain Number 2 Region: 69-122
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 0.00000000139
Family RNA polymerase alpha subunit dimerisation domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F5VIR6
Sequence length 124
Comment (tr|A0A0F5VIR6|A0A0F5VIR6_9ACTN) DNA-directed RNA polymerase subunit alpha {ECO:0000313|EMBL:KKD02009.1} KW=Complete proteome; Reference proteome OX=1415558 OS=Streptomyces sp. WM6386. GN=TN53_42920 OC=Streptomyces.
Sequence
EPVVMYLRKQGPGLVTAADIAPPAGVEVHNPDLVLATLNGKGKLEMELTVERGRGYVSAV
QNKQVGQEIGRIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLIVDVETKQAMRPRDAMAS
AGKT
Download sequence
Identical sequences A0A0F5VIR6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]