SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F5VPG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F5VPG4
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.63e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000634
Further Details:      
 
Domain Number 2 Region: 70-143
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.35e-26
Family Ribosomal protein L11, C-terminal domain 0.0000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F5VPG4
Sequence length 144
Comment (tr|A0A0F5VPG4|A0A0F5VPG4_9ACTN) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome; Reference proteome OX=1415558 OS=Streptomyces sp. WM6386. GN=TN53_33500 OC=Streptomyces.
Sequence
MPPKKKKVTGLIKLQINAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGWVIPVE
ITVYEDRSFTFITKTPPAAKMILKAAGVEKGSGEPHKTKVAKITEAQVREIATTKLPDLN
ANDLDAASKIIAGTARSMGITVEG
Download sequence
Identical sequences A0A086GXN7 A0A0F5VPG4 A0A0M9ZJL7 A0A0N1GSE8 A0A0T1TNC3 A0A117QG33 A0A1V9WG02
WP_020132675.1.100664 WP_020132675.1.15319 WP_020132675.1.20195 WP_020132675.1.25160 WP_020132675.1.27512 WP_020132675.1.43635 WP_020132675.1.46933 WP_020132675.1.47326 WP_020132675.1.64164 WP_020132675.1.64625 WP_020132675.1.67723 WP_020132675.1.74345 WP_020132675.1.88324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]