SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6BJW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6BJW7
Domain Number - Region: 32-93
Classification Level Classification E-value
Superfamily Staphylokinase/streptokinase 0.0484
Family Staphylokinase/streptokinase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6BJW7
Sequence length 358
Comment (tr|A0A0F6BJW7|A0A0F6BJW7_GEOS0) Lipoprotein LpqB, GerMN domain protein {ECO:0000313|EMBL:ADP73718.1} KW=Complete proteome; Reference proteome OX=581103 OS=Geobacillus sp. (strain Y4.1MC1). GN=GY4MC1_0904 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MFNRGARKLAASVAALLLLLSGCGLFGKDGAVKEIDPPQDVSYLEEGQSLQKTTEKQKEE
KSVNKATETVKRELYLIDKNGFVVPQTVELPKTDAVAKQVLEYLVEDGPVSEMLPNGFRA
VLPADTRVLGVKLEKDGTIIADFSPEFANYRPEDEKKILQAITWTLTQFDNVKKVKIRIN
GYDQDVMPVNKTPIQDGVSRADGINIEASGVIDITNTHPVTVYFVAQQGSNTYYVPVTRR
VSNKEKDDIVAAVNELIKGPSYGSGLLSEFQPDTQLLGKPKYEDGKVTLNFNEAIYGSNK
KNVILDHVLNSLVLSLTEQKGIESVAITVNGKANLVKEDGKTLSEPVTRPENVNAESF
Download sequence
Identical sequences A0A0F6BJW7 A0A150LNT0 A0A178U0H3
WP_003248790.1.100411 WP_003248790.1.10372 WP_003248790.1.21702 WP_003248790.1.26140 WP_003248790.1.44525 WP_003248790.1.50686 WP_003248790.1.65251 WP_003248790.1.95592 WP_003248790.1.96739 gi|312110013|ref|YP_003988329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]