SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F6FEG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6FEG9
Domain Number - Region: 8-69
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6FEG9
Sequence length 73
Comment (tr|A0A0F6FEG9|A0A0F6FEG9_ECO57) Ankyrin-repeat protein A {ECO:0000313|EMBL:AJA28809.1} KW=Complete proteome OX=1330457 OS=Escherichia coli O157:H7 str. SS52. GN=SS52_5004 OC=Enterobacteriaceae; Escherichia.
Sequence
MGLWLKIFKIVVGENENYLKDVMMQLEAKNNEGKYVISKANGNPVFKELFWKAIDEFNFP
QEELNRLKQYRSL
Download sequence
Identical sequences A0A0F6FEG9 A0A143E153 A0A152UTN9
gi|254795710|ref|YP_003080547.1| gi|15804301|ref|NP_290340.1| 155864.Z5199 544404.ECSP_4753 WP_001303731.1.18112 WP_001303731.1.19419 WP_001303731.1.20264 WP_001303731.1.34224 WP_001303731.1.35349 WP_001303731.1.38835 WP_001303731.1.44203 WP_001303731.1.45404 WP_001303731.1.50304 WP_001303731.1.5486 WP_001303731.1.55286 WP_001303731.1.55492 WP_001303731.1.57068 WP_001303731.1.60935 WP_001303731.1.61772 WP_001303731.1.6511 WP_001303731.1.74251 WP_001303731.1.7536 WP_001303731.1.76448 WP_001303731.1.86105 WP_001303731.1.89852 WP_001303731.1.96480 WP_001303731.1.99182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]