SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6H3U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6H3U7
Domain Number - Region: 11-43
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0157
Family C-terminal domain of RNA polymerase alpha subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6H3U7
Sequence length 68
Comment (tr|A0A0F6H3U7|A0A0F6H3U7_LEPIR) Uncharacterized protein {ECO:0000313|EMBL:EKO22869.1} KW=Complete proteome OX=1049937 OS=Leptospira interrogans str. UI 12621. GN=LEP1GSC104_1436 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MFSEPNLTLFFSNPSINSIGDLNKSSMENRIKWENIGKTFSKILKFDVRKSGRIRLATGR
PDRALSSG
Download sequence
Identical sequences A0A0F6H3U7 M5ZC13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]