SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6ICS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6ICS5
Domain Number - Region: 19-67
Classification Level Classification E-value
Superfamily BEACH domain 0.0102
Family BEACH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6ICS5
Sequence length 191
Comment (tr|A0A0F6ICS5|A0A0F6ICS5_LEPIR) Uncharacterized protein {ECO:0000313|EMBL:EMJ35850.1} KW=Complete proteome OX=1193040 OS=Leptospira interrogans str. FPW1039. GN=LEP1GSC079_0225 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MLRNFFSLGKLNYLNLFYDTVLLPISVEREFLSNQLPPQELENRFDFIFGFFKSNSNWFE
RCNLYSEEEFQIYLADFKPEEKKLGIGEAEVFCQFTHTQGIAEILIDDLKAYNFGKSLSA
SVKRTLYFLTELDHNNILDYFESCKILKNSGTRISHEVILKAFSSSYESRGFPVPYDRIP
FWCRVSNMIEP
Download sequence
Identical sequences A0A0F6ICS5 M3F1V8 M6HIM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]