SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F6MF19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6MF19
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-75
Family Methylesterase CheB, C-terminal domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.01e-27
Family CheY-related 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6MF19
Sequence length 349
Comment (tr|A0A0F6MF19|A0A0F6MF19_SHIFL) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1086030 OS=Shigella flexneri 5a str. M90T. GN=SF5M90T_1876 OC=Enterobacteriaceae; Shigella.
Sequence
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLATISAGQAIRI
Download sequence
Identical sequences A0A0F6MF19 A0A127GJF5 A0A1W2N097 A0A200L713 A0A226KAC3 D2AI75 I6H310 Q0T3N7 Q83R52
gi|24113268|ref|NP_707778.1| NP_707778.1.23235 WP_000036372.1.101522 WP_000036372.1.101545 WP_000036372.1.101667 WP_000036372.1.10226 WP_000036372.1.10361 WP_000036372.1.11912 WP_000036372.1.12965 WP_000036372.1.13157 WP_000036372.1.17680 WP_000036372.1.17711 WP_000036372.1.19024 WP_000036372.1.19453 WP_000036372.1.20484 WP_000036372.1.22328 WP_000036372.1.22409 WP_000036372.1.22522 WP_000036372.1.22771 WP_000036372.1.22896 WP_000036372.1.23622 WP_000036372.1.2395 WP_000036372.1.2433 WP_000036372.1.24547 WP_000036372.1.25038 WP_000036372.1.25799 WP_000036372.1.26005 WP_000036372.1.27472 WP_000036372.1.27957 WP_000036372.1.28491 WP_000036372.1.2931 WP_000036372.1.30640 WP_000036372.1.3176 WP_000036372.1.35368 WP_000036372.1.35649 WP_000036372.1.35698 WP_000036372.1.36129 WP_000036372.1.37155 WP_000036372.1.37549 WP_000036372.1.37637 WP_000036372.1.37730 WP_000036372.1.38119 WP_000036372.1.38202 WP_000036372.1.39063 WP_000036372.1.39358 WP_000036372.1.41339 WP_000036372.1.41372 WP_000036372.1.41391 WP_000036372.1.41449 WP_000036372.1.41513 WP_000036372.1.41539 WP_000036372.1.42448 WP_000036372.1.43561 WP_000036372.1.44222 WP_000036372.1.4445 WP_000036372.1.44627 WP_000036372.1.44671 WP_000036372.1.4535 WP_000036372.1.45392 WP_000036372.1.45799 WP_000036372.1.45949 WP_000036372.1.46429 WP_000036372.1.47775 WP_000036372.1.4953 WP_000036372.1.49823 WP_000036372.1.51206 WP_000036372.1.51600 WP_000036372.1.51736 WP_000036372.1.52406 WP_000036372.1.5291 WP_000036372.1.54032 WP_000036372.1.54755 WP_000036372.1.54989 WP_000036372.1.55070 WP_000036372.1.56358 WP_000036372.1.57150 WP_000036372.1.57348 WP_000036372.1.58136 WP_000036372.1.59165 WP_000036372.1.59226 WP_000036372.1.60342 WP_000036372.1.63350 WP_000036372.1.63554 WP_000036372.1.63612 WP_000036372.1.64153 WP_000036372.1.64793 WP_000036372.1.64930 WP_000036372.1.65484 WP_000036372.1.66059 WP_000036372.1.66978 WP_000036372.1.6701 WP_000036372.1.67412 WP_000036372.1.67802 WP_000036372.1.69404 WP_000036372.1.69868 WP_000036372.1.70191 WP_000036372.1.70251 WP_000036372.1.70341 WP_000036372.1.71158 WP_000036372.1.71724 WP_000036372.1.72342 WP_000036372.1.72449 WP_000036372.1.72748 WP_000036372.1.74509 WP_000036372.1.75124 WP_000036372.1.75505 WP_000036372.1.76447 WP_000036372.1.76460 WP_000036372.1.76957 WP_000036372.1.77198 WP_000036372.1.78041 WP_000036372.1.78377 WP_000036372.1.80463 WP_000036372.1.80966 WP_000036372.1.81582 WP_000036372.1.81876 WP_000036372.1.81956 WP_000036372.1.82507 WP_000036372.1.83286 WP_000036372.1.83321 WP_000036372.1.83340 WP_000036372.1.84164 WP_000036372.1.84986 WP_000036372.1.84990 WP_000036372.1.85008 WP_000036372.1.85416 WP_000036372.1.85969 WP_000036372.1.86483 WP_000036372.1.88735 WP_000036372.1.89998 WP_000036372.1.90065 WP_000036372.1.90314 WP_000036372.1.92123 WP_000036372.1.93605 WP_000036372.1.94190 WP_000036372.1.95254 WP_000036372.1.95712 WP_000036372.1.96128 WP_000036372.1.96608 WP_000036372.1.96680 WP_000036372.1.96769 WP_000036372.1.96932 WP_000036372.1.97279 WP_000036372.1.97815 WP_000036372.1.98323 WP_000036372.1.99119 gi|384543544|ref|YP_005727607.1| gi|30063335|ref|NP_837506.1| gi|110805863|ref|YP_689383.1| 198214.SF1932 198215.S2023 373384.SFV_1929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]