SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F6MMV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6MMV1
Domain Number 1 Region: 807-1184
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.02e-127
Family PFOR PP module 0.00000000575
Further Details:      
 
Domain Number 2 Region: 424-676
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-83
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000029
Further Details:      
 
Domain Number 3 Region: 5-260
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.47e-74
Family PFOR Pyr module 0.0000000268
Further Details:      
 
Domain Number 4 Region: 261-422
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.14e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000101
Further Details:      
 
Domain Number 5 Region: 673-846
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.17e-22
Family Ferredoxin domains from multidomain proteins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6MMV1
Sequence length 1186
Comment (tr|A0A0F6MMV1|A0A0F6MMV1_TREDN) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome OX=999434 OS=Treponema denticola OTK. GN=HMPREF9723_01800 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MSQEKKLVMIDGNTAAGHVAHALSEVIAIYPITPSSPMGEVADEYSARGRENIWGTVPDV
VELQSEGGAAGAVHGALTTGALSSTFTASQGLLLMIPNMYKIAGELTSTVFHIAARAVAC
SALSIFGDHQDVMACRQTGWAMLASNSVQEVMDLAIISHAATLEARVPFLHFFDGFRTSH
EIQKIEEVSYDIMRQMVSDELVRAHRKRGLTPEKPELRGTAQNPDIYFQGREAVNKYYLA
TPEIVQKQMDKYAKLTGRQYHLYDYYGAKDAEQIIILMGSGADTVEETVDELNSKGGKYG
VIKVRLYRPFSAEHFVKAIPTTVKGIAVLDRCKEAGSLGEPLYEDVRTAIGEMQAAKKCP
FTHYPVIIGGRYGLGSKEFTPAMVKGVFDNLEGEKKTNFSVGIEDDVTHTSIKYDPNFKL
EDKDMHQAMFFGLGSDGTVGANKNSIKIIGEATDNKAQAYFSYDSKKSGGFTISHLRFGK
HAIRKPYLITNADFVACHKFSYLETYDMLHSLKKGGTFLLNAPYGKNEIWDNMPVEVQKQ
IIEKEAKFYVIDAIKIAEKAGMGNRINVVMQTAFFKIFGILPEAEAVDLIKKFIEKSYGK
KGPEIVQKNITTIDMALEGVEKVDYPKTATSKLKMHPAIAGDAPEFVKNVLGKVAIQKGD
DIKVSEMPEDGTFPTATTQYEKRAIAEHIPIWKSDICIQCGQCVMVCPHACIRMKAYDSS
LLAKAPQGFKSCDYKGKEFEGAKFTIQVSSEDCTGCGLCVQQCPAKSKENPEIKAINMEN
FVEHRKQEVANWNFFFNDIPDPDVKKLNLSVPKGIGMKRPLFEFSGACAGCGETPYVKLL
SQLFGDRAVIANATGCSSIYGGNLPTTPYAKRCDGRGPAWSNSLFEDAAEFGYGMRLTSD
KLAVYAREVAAKAKAKGIAAGVIDKILNNAQEDDAAIEEQRAFVAELKKELAGSKDELAK
ELDSLTDHFIKRSVWILGGDGWAYDIGYGGLDHVLASGKNINVLVMDTEVYSNTGGQMSK
ATPIGAVAKFAASGKEVSKKDLGMMAMSYGYVYVAHISMGANMSQVIKAFREAESYDGPS
IIIAYSHCINHGINMTKGMTNQKEAVSCGLWPLYRYDPRLVEQGKNPFQLDSKEPDFNLA
DFMYKEVRFKTLKNADPARAQMLLDKAVAKAKRQWQEYKYLADRPF
Download sequence
Identical sequences A0A0F6MMV1
WP_002692723.1.15337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]