SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6MNG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6MNG5
Domain Number - Region: 66-109
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.0497
Family Hypothetical protein TM0269 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6MNG5
Sequence length 169
Comment (tr|A0A0F6MNG5|A0A0F6MNG5_TREDN) Uncharacterized protein {ECO:0000313|EMBL:EMB20743.1} KW=Complete proteome OX=999434 OS=Treponema denticola OTK. GN=HMPREF9723_02203 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MKHTKKIAFLIFFVSLFSVFPVYAEDTKVSKTPDPYGAEEFKQWQKDLRRFEIITFGALP
FVSLLSFWAYDIGRSIAHKGDPAYNPWPLKDAKIAVKLTEKEQLGVFLTAVGISLGVAII
DITYRSIKRANAKKLEEKNEEPAILLIPIEENKSEETETSKTEESNDAQ
Download sequence
Identical sequences A0A0F6MNG5
WP_002693275.1.15337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]