SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6NEF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6NEF5
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 1.28e-94
Family Cytochrome f, large domain 0.0000000175
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.32e-20
Family Cytochrome f, small domain 0.0000669
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000144
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6NEF5
Sequence length 320
Comment (tr|A0A0F6NEF5|A0A0F6NEF5_LATPG) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=457904 OS=graminifolius). GN=petA OC=Fabeae; Lathyrus.
Sequence
MQTRNDFSWIKKEITRSISVLLMIHIITRAPISNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVRQVLANGKKGALNVGAVLILPEGFELAP
PHRLSPEIKEKIGNLSFQSYRPTKKNILVIGPVPGKKYSEITFPILSPDPATKRDVYFLK
YPLYVGGNRGRGQIYPDGSKSNNNVYNATATGVVNKIIRKEKGGYEITIVDASDGREVID
ILPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLLFLASIILAQ
IFLVLKKKQFEKVQLSEMNF
Download sequence
Identical sequences A0A0F6NEF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]