SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6NEP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6NEP6
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Ribosomal protein L36 8.24e-17
Family Ribosomal protein L36 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6NEP6
Sequence length 37
Comment (tr|A0A0F6NEP6|A0A0F6NEP6_LATPG) 50S ribosomal protein L36, chloroplastic {ECO:0000256|HAMAP-Rule:MF_00251} OX=457904 OS=graminifolius). GN=rpl36 OC=Fabeae; Lathyrus.
Sequence
MKVAASVRKICEKCRLIRRRGRLIVICSNPKHKQRQG
Download sequence
Identical sequences A0A023I2X6 A0A0F6NE45 A0A0F6NEH5 A0A0F6NEP6 A0A0F6NFD1 A0A0F6NFI3 A0A0F6NFV6 A0A0F6NFX5 A0A0F6NG07 A0A0F6NKK9 A0A0F6NKS8 A0A0F6NLK9 A0A0K0LXS5 A0A0X8GHI8 A0A0X8GHJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]