SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F6NYU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6NYU3
Domain Number 1 Region: 203-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.96e-56
Family Pyruvate oxidase and decarboxylase Pyr module 0.027
Further Details:      
 
Domain Number 2 Region: 10-224
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.59e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 3 Region: 473-571
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.57e-18
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6NYU3
Sequence length 578
Comment (tr|A0A0F6NYU3|A0A0F6NYU3_9PROT) 2-oxoglutarate ferredoxin oxidoreductase subunit A {ECO:0000313|EMBL:AIW63108.1} OX=1007128 OS=Magnetospirillum sp. pMbN1. GN= OC=Rhodospirillaceae; Magnetospirillum.
Sequence
MTTSSGSGSVSIAMCGSGGAGVMTAANMFLDAAAEAGYYALFGRSSGPQIRGGEAAALVR
LGVDPITSVDDTFDIMLAIDWQGVQRFAAELPLSKNSLVICDPSAGDVPEVYVKTGAKIV
HLHMKDLAKEIPGGRPNMIALGAIAELIGIPVGPLTEVLGKSLKKKRADAYEASVAGVKA
GAAAAATLTGSKRLAAAKAKDAKRWTVTGNYGAGLGAIRGGVRFCAAYPITPATEVLEYL
SSALPKVGGVFVQAEDELASINMCLGASYGGEASITATAGPGLSLMTEGLGLAVASETPV
VVVDVQRVGPSTGIATKCEQSDLNIAVYGLHGDAPHVVVAPNSVGDCIFTTQWGVYLAES
LQTACLVMSDQALGQSRAIIDAPADVAFVGKRLQAEAPAEGEVFKRYANTASGVSPMPVP
GQDGCQYTSDGLEHTETGTPSSQSSDHTLQLDKRQRKLTGFDYGNHWATIEGEGDIAVIT
WGSCTGAAREAVERAKADGVNAKLISLRLISPIRPQHMADALKGVKKILVVEQSHLGQFT
RYLRGEYDLPAKPEALSRPGPLPMRPGEIHARLLSMGK
Download sequence
Identical sequences A0A0F6NYU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]